Lineage for d1j3fa_ (1j3f A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2687850Protein Myoglobin [46469] (11 species)
  7. 2688020Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (318 PDB entries)
    Uniprot P02185
  8. 2688047Domain d1j3fa_: 1j3f A: [103835]
    complexed with cr, czm, po4

Details for d1j3fa_

PDB Entry: 1j3f (more details), 1.45 Å

PDB Description: crystal structure of an artificial metalloprotein:cr(iii)(3,3'-me2- salophen)/apo-a71g myoglobin
PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d1j3fa_:

Sequence, based on SEQRES records: (download)

>d1j3fa_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]}
mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
dlkkhgvtvltglgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
pgdfgadaqgamnkalelfrkdiaakykelgyqg

Sequence, based on observed residues (ATOM records): (download)

>d1j3fa_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]}
mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
dlkkhgvtvltglgailkkkghheaelkplaqshatkipikylefiseaiihvlhsrhpg
dfgadaqgamnkalelfrkdiaakykelgyqg

SCOPe Domain Coordinates for d1j3fa_:

Click to download the PDB-style file with coordinates for d1j3fa_.
(The format of our PDB-style files is described here.)

Timeline for d1j3fa_: