Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.228: Replication modulator SeqA, C-terminal DNA-binding domain [82807] (1 superfamily) consists of seven alpha-helices and three-stranded beta-sheet |
Superfamily d.228.1: Replication modulator SeqA, C-terminal DNA-binding domain [82808] (1 family) automatically mapped to Pfam PF03925 |
Family d.228.1.1: Replication modulator SeqA, C-terminal DNA-binding domain [82809] (2 proteins) |
Protein Replication modulator SeqA, C-terminal DNA-binding domain [82810] (1 species) binds to fully methylated and hemimethylated GATC sequences at oriC |
Species Escherichia coli [TaxId:562] [82811] (3 PDB entries) Uniprot P36658 71-181 |
Domain d1j3ea1: 1j3e A:6-116 [103834] Other proteins in same PDB: d1j3ea2 protein/DNA complex |
PDB Entry: 1j3e (more details), 2.5 Å
SCOPe Domain Sequences for d1j3ea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j3ea1 d.228.1.1 (A:6-116) Replication modulator SeqA, C-terminal DNA-binding domain {Escherichia coli [TaxId: 562]} amrelllsdeyaeqkravnrfmlllstlysldaqafaeateslhgrtrvyfaadeqtllk ngnqtkpkhvpgtpywvitntntgrkcsmiehimqsmqfpaeliekvcgti
Timeline for d1j3ea1: