Lineage for d1j3da_ (1j3d A:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.21: HMG-box [47094] (1 superfamily)
    3 helices; irregular array
  4. Superfamily a.21.1: HMG-box [47095] (2 families) (S)
  5. Family a.21.1.1: HMG-box [47096] (10 proteins)
  6. Protein High mobility group protein 2, HMG2 [109762] (1 species)
  7. Species Pig (Sus scrofa) [TaxId:9823] [109763] (3 PDB entries)
    Uniprot P17741 1-77, 89-163
  8. Domain d1j3da_: 1j3d A: [103833]
    domain B

Details for d1j3da_

PDB Entry: 1j3d (more details)

PDB Description: Solution structure of the C-terminal domain of the HMGB2
PDB Compounds: (A:) High mobility group protein 2

SCOPe Domain Sequences for d1j3da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j3da_ a.21.1.1 (A:) High mobility group protein 2, HMG2 {Pig (Sus scrofa) [TaxId: 9823]}
mkkdpnapkrppsafflfcsehrpkiksehpglsigdtakklgemwseqsakdkqpyeqk
aaklkekyekdiaayrak

SCOPe Domain Coordinates for d1j3da_ are not available.

Timeline for d1j3da_: