Lineage for d1j2ga1 (1j2g A:7-158)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 868802Fold d.96: T-fold [55619] (2 superfamilies)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
    tunnel-shaped: its known members form wide oligomeric barrels different sizes
  4. 868803Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (4 families) (S)
    bind purine or pterin in topologically similar sites between subunits
  5. 869038Family d.96.1.4: Urate oxidase (uricase) [55633] (1 protein)
  6. 869039Protein Urate oxidase (uricase) [55634] (3 species)
    duplication: one subunit consists of two domains of this fold; beta-sheets of two subunits form a barrel, closed: n=16, S=16
  7. 869228Species Bacillus sp., strain TB-90 [TaxId:1409] [111089] (1 PDB entry)
    Uniprot Q45697 177-482
  8. 869229Domain d1j2ga1: 1j2g A:7-158 [103824]

Details for d1j2ga1

PDB Entry: 1j2g (more details), 2.2 Å

PDB Description: Crystal structure of Urate oxidase from Bacillus SP. TB-90 co-crystallized with 8-Azaxanthine
PDB Compounds: (A:) Uricase

SCOP Domain Sequences for d1j2ga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j2ga1 d.96.1.4 (A:7-158) Urate oxidase (uricase) {Bacillus sp., strain TB-90 [TaxId: 1409]}
rvmyygkgdvfayrtylkpltgvrtipespfsgrdhilfgvnvkisvggtklltsftkgd
nslvvatdsmknfiqkhlasytgttiegfleyvatsflkkyshiekisligeeipfettf
avkngnraaselvfkksrneyataylnmvrne

SCOP Domain Coordinates for d1j2ga1:

Click to download the PDB-style file with coordinates for d1j2ga1.
(The format of our PDB-style files is described here.)

Timeline for d1j2ga1: