Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
Fold d.96: T-fold [55619] (1 superfamily) beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234 tunnel-shaped: its known members form wide oligomeric barrels different sizes |
Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (4 families) bind purine or pterin in topologically similar sites between subunits |
Family d.96.1.4: Urate oxidase (uricase) [55633] (1 protein) |
Protein Urate oxidase (uricase) [55634] (2 species) duplication: one subunit consists of two domains of this fold; beta-sheets of two subunits form a barrel, closed: n=16, S=16 |
Species Bacillus sp., strain TB-90 [TaxId:1409] [111089] (1 PDB entry) |
Domain d1j2ga1: 1j2g A:7-158 [103824] |
PDB Entry: 1j2g (more details), 2.2 Å
SCOP Domain Sequences for d1j2ga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j2ga1 d.96.1.4 (A:7-158) Urate oxidase (uricase) {Bacillus sp., strain TB-90} rvmyygkgdvfayrtylkpltgvrtipespfsgrdhilfgvnvkisvggtklltsftkgd nslvvatdsmknfiqkhlasytgttiegfleyvatsflkkyshiekisligeeipfettf avkngnraaselvfkksrneyataylnmvrne
Timeline for d1j2ga1:
View in 3D Domains from same chain: (mouse over for more information) d1j2ga2, d1j2ga3, d1j2ga4, d1j2ga5 |