Lineage for d1j26a_ (1j26 A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1904269Fold d.50: dsRBD-like [54767] (5 superfamilies)
    alpha-beta(3)-alpha; 2 layers: alpha/beta
  4. 1904486Superfamily d.50.4: Peptidyl-tRNA hydrolase domain-like [110916] (1 family) (S)
  5. 1904487Family d.50.4.1: Peptidyl-tRNA hydrolase domain [110917] (1 protein)
    Pfam PF00472; related to domain 3 of the Polypeptide chain release factors RF1 and RF2 (75621)
  6. 1904488Protein Ict1 protein [110918] (1 species)
  7. 1904489Species Mouse (Mus musculus) [TaxId:10090] [110919] (1 PDB entry)
    Uniprot Q8R035 63-162
  8. 1904490Domain d1j26a_: 1j26 A: [103823]

Details for d1j26a_

PDB Entry: 1j26 (more details)

PDB Description: Solution structure of a putative peptidyl-tRNA hydrolase domain in a mouse hypothetical protein
PDB Compounds: (A:) immature colon carcinoma transcript 1

SCOPe Domain Sequences for d1j26a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j26a_ d.50.4.1 (A:) Ict1 protein {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgehakqassyipldrlsisycrssgpggqnvnkvnskaevrfhlasadwieepv
rqkialthknkinkagelvltsessryqfrnlaeclqkirdmiaeasgpssg

SCOPe Domain Coordinates for d1j26a_:

Click to download the PDB-style file with coordinates for d1j26a_.
(The format of our PDB-style files is described here.)

Timeline for d1j26a_: