Lineage for d1hl1a2 (1hl1 A:183-356)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 457650Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 457651Superfamily b.6.1: Cupredoxins [49503] (6 families) (S)
    contains copper-binding site
  5. 457981Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins)
  6. 458299Protein Spore coat protein A, CotA [89219] (1 species)
  7. 458300Species Bacillus subtilis [TaxId:1423] [89220] (7 PDB entries)
  8. 458320Domain d1hl1a2: 1hl1 A:183-356 [103821]

Details for d1hl1a2

PDB Entry: 1hl1 (more details), 2.69 Å

PDB Description: crystal structure of bacillus subtilis cota after20h soaking with abts

SCOP Domain Sequences for d1hl1a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hl1a2 b.6.1.3 (A:183-356) Spore coat protein A, CotA {Bacillus subtilis}
klpsdeydvpllitdrtinedgslfypsapenpspslpnpsivpafcgetilvngkvwpy
leveprkyrfrvinasntrtynlsldnggdfiqigsdggllprsvklnsfslapaerydi
iidftayegesiilansagcggdvnpetdanimqfrvtkplaqkdesrkpkyla

SCOP Domain Coordinates for d1hl1a2:

Click to download the PDB-style file with coordinates for d1hl1a2.
(The format of our PDB-style files is described here.)

Timeline for d1hl1a2: