Class b: All beta proteins [48724] (144 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (6 families) contains copper-binding site |
Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins) |
Protein Spore coat protein A, CotA [89219] (1 species) |
Species Bacillus subtilis [TaxId:1423] [89220] (7 PDB entries) |
Domain d1hkza3: 1hkz A:357-510 [103816] |
PDB Entry: 1hkz (more details), 2.49 Å
SCOP Domain Sequences for d1hkza3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hkza3 b.6.1.3 (A:357-510) Spore coat protein A, CotA {Bacillus subtilis} sypsvqheriqnirtlklagtqdeygrpvlllnnkrwhdpvtetpkvgtteiwsiinptr gthpihlhlvsfrvldrrpfdiaryqesgelsytgpavppppsekgwkdtiqahagevlr iaatfgpysgryvwhchilehedydmmrpmditd
Timeline for d1hkza3: