![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
![]() | Superfamily g.3.2: Plant inhibitors of proteinases and amylases [57027] (1 family) ![]() |
![]() | Family g.3.2.1: Plant inhibitors of proteinases and amylases [57028] (4 proteins) |
![]() | Protein Trypsin inhibitor [57029] (5 species) |
![]() | Species Jumping cucumber (Ecballium elaterium) [TaxId:3679] [57033] (7 PDB entries) Uniprot P12071 |
![]() | Domain d1h9hi_: 1h9h I: [103811] Other proteins in same PDB: d1h9he_ complexed with ca |
PDB Entry: 1h9h (more details), 1.5 Å
SCOPe Domain Sequences for d1h9hi_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h9hi_ g.3.2.1 (I:) Trypsin inhibitor {Jumping cucumber (Ecballium elaterium) [TaxId: 3679]} gcprilirckqdsdclagcvcgpngfcgsp
Timeline for d1h9hi_: