SCOPe 2.08: Domain d1un9b4: 1un9 B:1-335

Lineage for d1un9b4 (1un9 B:1-335)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.119: DAK1/DegV-like [82548] (1 superfamily)
   2 different domains; d1: [core: 3 layers, a/b/a; parallel sheet of 5 strands, order: 2134]; D2: [2 layers, a/b; mixed sheet of 6 strands, order 321645; strands 2 and 6 are antiparallel to the rest]

4. Superfamily c.119.1: DAK1/DegV-like [82549] (3 families)
   domain folds and architecture show some similarity to the tubulin-like GTPases; the nucleotide-binding sites of the Dihydroxyacetone kinase and tubulin families are different

5. Family c.119.1.2: DAK1 [109613] (3 proteins)
   Pfam PF02733

6. Protein Dihydroxyacetone kinase [109616] (1 species)
   contains additional alpha-helical, ATP-binding domain

7. Species Citrobacter freundii [TaxId:546] [109617] (2 PDB entries)

8. Domain d1un9b4: 1un9 B:1-335 [103809]
   Other proteins in same PDB: d1un9a1, d1un9b1
   complexed with 2ha, anp, mg

Details for d1un9b4

PDB Entry: 1un9, 3.1 Å

PDB Description: crystal structure of the dihydroxyacetone kinase from c. freundii in complex with amp-pnp and mg2+

PDB Compounds: (B:) dihydroxyacetone kinase

SCOPe Domain Sequences for d1un9b4:

Sequence; same for both SEQRES and ATOM records:

>d1un9b4 c.119.1.2 (B:1-335) Dihydroxyacetone kinase {Citrobacter freundii [TaxId: 546]}
asqfffnqrthlvsdvidgaiiaspwnnlarlesdpairivvrrdlnknnvavisgggsg
hepahvgfigkgmltaavcgdvfaspsvdavltaiqavtgeagcllivknytgdrlnfgl
aaekarrlgynvemlivgddislpdnkhprgiagtilvhkiagyfaergynlatvlreaq
yaasntfslgvalsschlpqetdaaprhhpghaelgmgihgepgasvidtqnsaqvvnlm
vdkllaalpetgrlavminnlggvsvaemaiitrelassplhsridwligpaslvtaldm
kgfsltaivleesiekalltevetsnwptpvppre

Timeline for d1un9b4:

• d1un9b4 first appeared in SCOP 1.69
  
• d1un9b4 appears in SCOPe 2.07