Lineage for d1un9a4 (1un9 A:1-335)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 712911Fold c.119: DAK1/DegV-like [82548] (1 superfamily)
    2 different domains; d1: [core: 3 layers, a/b/a; parallel sheet of 5 strands, order: 2134]; D2: [2 layers, a/b; mixed sheet of 6 strands, order 321645; strands 2 and 6 are antiparallel to the rest]
  4. 712912Superfamily c.119.1: DAK1/DegV-like [82549] (2 families) (S)
    domain folds and architecture show some similarity to the tubulin-like GTPases; the nucleotide-binding sites of the Dihydroxyacetone kinase and tubulin families are different
  5. 712923Family c.119.1.2: DAK1 [109613] (2 proteins)
    Pfam PF02733
  6. 712924Protein Dihydroxyacetone kinase [109616] (1 species)
    contains additional alpha-helical, ATP-binding domain
  7. 712925Species Citrobacter freundii [TaxId:546] [109617] (2 PDB entries)
  8. 712928Domain d1un9a4: 1un9 A:1-335 [103808]
    Other proteins in same PDB: d1un9a1, d1un9b1

Details for d1un9a4

PDB Entry: 1un9 (more details), 3.1 Å

PDB Description: crystal structure of the dihydroxyacetone kinase from c. freundii in complex with amp-pnp and mg2+
PDB Compounds: (A:) dihydroxyacetone kinase

SCOP Domain Sequences for d1un9a4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1un9a4 c.119.1.2 (A:1-335) Dihydroxyacetone kinase {Citrobacter freundii [TaxId: 546]}
asqfffnqrthlvsdvidgaiiaspwnnlarlesdpairivvrrdlnknnvavisgggsg
hepahvgfigkgmltaavcgdvfaspsvdavltaiqavtgeagcllivknytgdrlnfgl
aaekarrlgynvemlivgddislpdnkhprgiagtilvhkiagyfaergynlatvlreaq
yaasntfslgvalsschlpqetdaaprhhpghaelgmgihgepgasvidtqnsaqvvnlm
vdkllaalpetgrlavminnlggvsvaemaiitrelassplhsridwligpaslvtaldm
kgfsltaivleesiekalltevetsnwptpvppre

SCOP Domain Coordinates for d1un9a4:

Click to download the PDB-style file with coordinates for d1un9a4.
(The format of our PDB-style files is described here.)

Timeline for d1un9a4:

View in 3D
Domains from same chain:
(mouse over for more information)
d1un9a1