Lineage for d1un8b4 (1un8 B:1-335)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 496281Fold c.119: DAK1/DegV-like [82548] (1 superfamily)
    2 different domains; d1: [core: 3 layers, a/b/a; parallel sheet of 5 strands, order: 2134]; D2: [2 layers, a/b; mixed sheet of 6 strands, order 321645; strands 2 and 6 are antiparallel to the rest]
  4. 496282Superfamily c.119.1: DAK1/DegV-like [82549] (2 families) (S)
    domain folds and architecture show some similarity to the tubulin-like GTPases; the nucleotide-binding sites of the Dihydroxyacetone kinase and tubulin families are different
  5. 496291Family c.119.1.2: DAK1 (Pfam 02733) [109613] (2 proteins)
  6. 496292Protein Dihydroxyacetone kinase [109616] (1 species)
    contains additional alpha-helical, ATP-binding domain
  7. 496293Species Citrobacter freundii [TaxId:546] [109617] (2 PDB entries)
  8. 496295Domain d1un8b4: 1un8 B:1-335 [103807]
    Other proteins in same PDB: d1un8a1, d1un8b1

Details for d1un8b4

PDB Entry: 1un8 (more details), 2.5 Å

PDB Description: crystal structure of the dihydroxyacetone kinase of c. freundii (native form)

SCOP Domain Sequences for d1un8b4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1un8b4 c.119.1.2 (B:1-335) Dihydroxyacetone kinase {Citrobacter freundii}
msqfffnqrthlvsdvidgaiiaspwnnlarlesdpairivvrrdlnknnvavisgggsg
hepahvgfigkgmltaavcgdvfaspsvdavltaiqavtgeagcllivknytgdrlnfgl
aaekarrlgynvemlivgddislpdnkhprgiagtilvhkiagyfaergynlatvlreaq
yaasntfslgvalsschlpqetdaaprhhpghaelgmgihgepgasvidtqnsaqvvnlm
vdkllaalpetgrlavminnlggvsvaemaiitrelassplhsridwligpaslvtaldm
kgfsltaivleesiekalltevetsnwptpvppre

SCOP Domain Coordinates for d1un8b4:

Click to download the PDB-style file with coordinates for d1un8b4.
(The format of our PDB-style files is described here.)

Timeline for d1un8b4:

View in 3D
Domains from same chain:
(mouse over for more information)
d1un8b1