Lineage for d5bj3b_ (5bj3 B:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 399758Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 399759Superfamily c.67.1: PLP-dependent transferases [53383] (6 families) (S)
  5. 399760Family c.67.1.1: AAT-like [53384] (7 proteins)
  6. 399805Protein Aspartate aminotransferase, AAT [53385] (8 species)
  7. 399919Species Thermus thermophilus [TaxId:274] [53391] (9 PDB entries)
  8. 399929Domain d5bj3b_: 5bj3 B: [100872]

Details for d5bj3b_

PDB Entry: 5bj3 (more details), 2.2 Å

PDB Description: thermus thermophilus aspartate aminotransferase tetra mutant 1

SCOP Domain Sequences for d5bj3b_:

Sequence, based on SEQRES records: (download)

>d5bj3b_ c.67.1.1 (B:) Aspartate aminotransferase, AAT {Thermus thermophilus}
mrglsrrvqamkpdapvavnakalelrrqgvdlvaltagepdfdtpehvkeaarralaqg
ktkyappagipelrealaekfrrenglsvtpeetivtvggsqalfnlfqaildpgdeviv
lspywvsypemvrfaggvvvevetlpeegfvpdpervrraitprtkalvvnspnnptgav
ypkevlealarlavehdfylvsdeiyehllyegehfspgrvapehtltvngaakafamtg
wrigyacgpkevikamasvsrqsttspdtiaqwatlealtnqeasrafvemareayrrrr
dlllegltalglkavrpsgafyvlmdtspiapdevraaerlleagvavvpgtdfaafghv
rlsyatseenlrkalerfarvl

Sequence, based on observed residues (ATOM records): (download)

>d5bj3b_ c.67.1.1 (B:) Aspartate aminotransferase, AAT {Thermus thermophilus}
mrglsrrvqamkplvaltagepdfdtpehvkeaarralaqgktkyappagipelrealae
kfrrenglsvtpeetivtvggsqalfnlfqaildpgdevivlspywvsypemvrfaggvv
vevetlpeegfvpdpervrraitprtkalvvnspnnptgavypkevlealarlavehdfy
lvsdeiyehllyegehfspgrvapehtltvngaakafamtgwrigyacgpkevikamasv
srqsttspdtiaqwatlealtnqeasrafvemareayrrrrdlllegltalglkavrpsg
afyvlmdtspiapdevraaerlleagvavvpgtdfaafghvrlsyatseenlrkalerfa
rvl

SCOP Domain Coordinates for d5bj3b_:

Click to download the PDB-style file with coordinates for d5bj3b_.
(The format of our PDB-style files is described here.)

Timeline for d5bj3b_: