Lineage for d3ck0l2 (3ck0 L:108-210)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1290587Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1293251Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)
  7. 1293486Species Mouse (Mus musculus) [TaxId:10090] [88567] (364 PDB entries)
    Uniprot P01837# KAC_MOUSE Ig kappa chain C region; 99% sequence identity ! SQ NA # natural chimera; best hits are: Uniprot P01637 (Ig kappa chain V-V region T1) and Uniprot P01837 (Ig kappa chain C region) ! Uniprot P01837 # KAC_MOUSE Ig kappa chain C region ! Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01837 # ! KAC_MOUSE Ig kappa chain C region
  8. 1293817Domain d3ck0l2: 3ck0 L:108-210 [100868]
    Other proteins in same PDB: d3ck0h1, d3ck0h2, d3ck0l1
    part of anti-anti-idiotypic Fab against human angiotensin II, complex with angiotensin II

Details for d3ck0l2

PDB Entry: 3ck0 (more details), 3 Å

PDB Description: anti-anti-idiotypic antibody against human angiotensin ii, complex with human angiotensin ii
PDB Compounds: (L:) protein (immunoglobulin; light chain)

SCOPe Domain Sequences for d3ck0l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ck0l2 b.1.1.2 (L:108-210) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivksfnr

SCOPe Domain Coordinates for d3ck0l2:

Click to download the PDB-style file with coordinates for d3ck0l2.
(The format of our PDB-style files is described here.)

Timeline for d3ck0l2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ck0l1