SCOP 1.69: Domain d3ck0l2: 3ck0 L:118-210

Lineage for d3ck0l2 (3ck0 L:118-210)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88567] (277 PDB entries)

8. Domain d3ck0l2: 3ck0 L:118-210 [100868]
   Other proteins in same PDB: d3ck0h1, d3ck0h2, d3ck0l1
   part of anti-anti-idiotypic Fab against human angiotensin II, complex with angiotensin II

Details for d3ck0l2

PDB Entry: 3ck0, 3 Å

PDB Description: anti-anti-idiotypic antibody against human angiotensin ii, complex with human angiotensin ii

SCOP Domain Sequences for d3ck0l2:

Sequence; same for both SEQRES and ATOM records:

>d3ck0l2 b.1.1.2 (L:118-210) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
ppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsst
ltltkdeyerhnsytceathktstspivksfnr

Timeline for d3ck0l2:

• d3ck0l2 first appeared in SCOP 1.67
  
• d3ck0l2 appears in SCOP 1.71
  
• d3ck0l2 appears in the current release, SCOPe 2.08