Lineage for d3ck0l2 (3ck0 L:118-210)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 364354Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 365639Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 365760Species Mouse (Mus musculus) [TaxId:10090] [88567] (270 PDB entries)
  8. 366017Domain d3ck0l2: 3ck0 L:118-210 [100868]
    Other proteins in same PDB: d3ck0h1, d3ck0h2, d3ck0l1
    part of anti-anti-idiotypic Fab against human angiotensin II, complex with angiotensin II

Details for d3ck0l2

PDB Entry: 3ck0 (more details), 3 Å

PDB Description: anti-anti-idiotypic antibody against human angiotensin ii, complex with human angiotensin ii

SCOP Domain Sequences for d3ck0l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ck0l2 b.1.1.2 (L:118-210) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
ppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsst
ltltkdeyerhnsytceathktstspivksfnr

SCOP Domain Coordinates for d3ck0l2:

Click to download the PDB-style file with coordinates for d3ck0l2.
(The format of our PDB-style files is described here.)

Timeline for d3ck0l2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ck0l1