SCOPe 2.06: Domain d3ck0h1: 3ck0 H:1-117

Lineage for d3ck0h1 (3ck0 H:1-117)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 1 [TaxId:10090] [88548] (68 PDB entries)
   Uniprot P01796 # ! HV27_MOUSE Ig heavy chain V-III region A4

8. Domain d3ck0h1: 3ck0 H:1-117 [100865]
   Other proteins in same PDB: d3ck0h2, d3ck0l1, d3ck0l2
   part of anti-anti-idiotypic Fab against human angiotensin II, complex with angiotensin II

Details for d3ck0h1

PDB Entry: 3ck0, 3 Å

PDB Description: anti-anti-idiotypic antibody against human angiotensin ii, complex with human angiotensin ii

PDB Compounds: (H:) protein (immunoglobulin; heavy chain)

SCOPe Domain Sequences for d3ck0h1:

Sequence; same for both SEQRES and ATOM records:

>d3ck0h1 b.1.1.1 (H:1-117) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1 [TaxId: 10090]}
qvqlqesggglvqprgslklscaasgftfntdamnwvrqapgkglewvarirskgfnfat
yyadsvrdrftisrddsqsmlylqmnnlktedtgiyycvrgrdgeamdywgqgttltvss

Timeline for d3ck0h1:

• d3ck0h1 first appeared in SCOP 1.67
  
• d3ck0h1 appears in SCOPe 2.05
  
• d3ck0h1 appears in SCOPe 2.07
  
• d3ck0h1 appears in the current release, SCOPe 2.08