Lineage for d3ck0h1 (3ck0 H:1-106)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 781544Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)
  6. 781740Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 781998Species Mouse (Mus musculus), cluster 1 [TaxId:10090] [88548] (47 PDB entries)
    Uniprot P01796 #
    HV27_MOUSE Ig heavy chain V-III region A4
    Uniprot P01796 # ! HV27_MOUSE Ig heavy chain V-III region A4
  8. 782042Domain d3ck0h1: 3ck0 H:1-106 [100865]
    Other proteins in same PDB: d3ck0h2, d3ck0l1, d3ck0l2
    part of anti-anti-idiotypic Fab against human angiotensin II, complex with angiotensin II

Details for d3ck0h1

PDB Entry: 3ck0 (more details), 3 Å

PDB Description: anti-anti-idiotypic antibody against human angiotensin ii, complex with human angiotensin ii
PDB Compounds: (H:) protein (immunoglobulin; heavy chain)

SCOP Domain Sequences for d3ck0h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ck0h1 b.1.1.1 (H:1-106) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1 [TaxId: 10090]}
qvqlqesggglvqprgslklscaasgftfntdamnwvrqapgkglewvarirskgfnfat
yyadsvrdrftisrddsqsmlylqmnnlktedtgiyycvrgrdgeamdy

SCOP Domain Coordinates for d3ck0h1:

Click to download the PDB-style file with coordinates for d3ck0h1.
(The format of our PDB-style files is described here.)

Timeline for d3ck0h1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ck0h2