Lineage for d2sgfi_ (2sgf I:)

  1. Root: SCOPe 2.03
  2. 1458801Class g: Small proteins [56992] (90 folds)
  3. 1465700Fold g.68: Kazal-type serine protease inhibitors [100894] (1 superfamily)
  4. 1465701Superfamily g.68.1: Kazal-type serine protease inhibitors [100895] (2 families) (S)
    conserved core consists of a helix and a loop crosslinked with two disulfides
  5. 1465702Family g.68.1.1: Ovomucoid domain III-like [57468] (11 proteins)
  6. 1465737Protein Ovomucoid domains [57469] (3 species)
    unless specified in the comment, the listed structures are of domain III
  7. 1465749Species Turkey (Meleagris gallopavo) [TaxId:9103] [57470] (37 PDB entries)
  8. 1465757Domain d2sgfi_: 2sgf I: [100862]
    Other proteins in same PDB: d2sgfe_
    complexed with po4

Details for d2sgfi_

PDB Entry: 2sgf (more details), 1.75 Å

PDB Description: phe 18 variant of turkey ovomucoid inhibitor third domain complexed with streptomyces griseus proteinase b
PDB Compounds: (I:) Ovomucoid

SCOPe Domain Sequences for d2sgfi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2sgfi_ g.68.1.1 (I:) Ovomucoid domains {Turkey (Meleagris gallopavo) [TaxId: 9103]}
vdcseypkpactfeyrplcgsdnktygnkcnfcnavvesngtltlshfgkc

SCOPe Domain Coordinates for d2sgfi_:

Click to download the PDB-style file with coordinates for d2sgfi_.
(The format of our PDB-style files is described here.)

Timeline for d2sgfi_: