SCOPe 2.08: Domain d2sgee_: 2sge E:

Lineage for d2sgee_ (2sge E:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.1: Prokaryotic proteases [50495] (16 proteins)

6. Protein Protease B [50508] (1 species)

7. Species Streptomyces griseus, strain k1 [TaxId:1911] [50509] (20 PDB entries)
   Streptogrisin B

8. Domain d2sgee_: 2sge E: [100859]
   Other proteins in same PDB: d2sgei_
   complexed with k, po4

Details for d2sgee_

PDB Entry: 2sge, 1.8 Å

PDB Description: glu 18 variant of turkey ovomucoid inhibitor third domain complexed with streptomyces griseus proteinase b at ph 10.7

PDB Compounds: (E:) Streptogrisin B

SCOPe Domain Sequences for d2sgee_:

Sequence; same for both SEQRES and ATOM records:

>d2sgee_ b.47.1.1 (E:) Protease B {Streptomyces griseus, strain k1 [TaxId: 1911]}
isggdaiysstgrcslgfnvrsgstyyfltaghctdgattwwansarttvlgttsgssfp
nndygivrytnttipkdgtvggqditsaanatvgmavtrrgsttgthsgsvtalnatvny
gggdvvygmirtnvcaepgdsggplysgtraigltsggsgncssggttffqpvtealsay
gvsvy

Timeline for d2sgee_:

• d2sgee_ first appeared in SCOP 1.67
  
• d2sgee_ appears in SCOPe 2.07