SCOPe 2.07: Domain d2sgde_: 2sgd E:

Lineage for d2sgde_ (2sgd E:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.1: Prokaryotic proteases [50495] (16 proteins)

6. Protein Protease B [50508] (1 species)

7. Species Streptomyces griseus, strain k1 [TaxId:1911] [50509] (20 PDB entries)
   Streptogrisin B

8. Domain d2sgde_: 2sgd E: [100857]
   Other proteins in same PDB: d2sgdi_
   complexed with k, po4

Details for d2sgde_

PDB Entry: 2sgd, 1.8 Å

PDB Description: asp 18 variant of turkey ovomucoid inhibitor third domain complexed with streptomyces griseus proteinase b at ph 10.7

PDB Compounds: (E:) Streptogrisin B

SCOPe Domain Sequences for d2sgde_:

Sequence; same for both SEQRES and ATOM records:

>d2sgde_ b.47.1.1 (E:) Protease B {Streptomyces griseus, strain k1 [TaxId: 1911]}
isggdaiysstgrcslgfnvrsgstyyfltaghctdgattwwansarttvlgttsgssfp
nndygivrytnttipkdgtvggqditsaanatvgmavtrrgsttgthsgsvtalnatvny
gggdvvygmirtnvcaepgdsggplysgtraigltsggsgncssggttffqpvtealsay
gvsvy

Timeline for d2sgde_:

• d2sgde_ first appeared in SCOP 1.67
  
• d2sgde_ appears in SCOPe 2.06
  
• d2sgde_ appears in the current release, SCOPe 2.08