![]() | Class b: All beta proteins [48724] (141 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
![]() | Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [88567] (270 PDB entries) |
![]() | Domain d2ck0l2: 2ck0 L:118-210 [100856] Other proteins in same PDB: d2ck0h1, d2ck0h2, d2ck0l1 part of anti-anti-idiotypic Fab against human angiotensin II, complex with a synthetic cyclic peptide |
PDB Entry: 2ck0 (more details), 2.2 Å
SCOP Domain Sequences for d2ck0l2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ck0l2 b.1.1.2 (L:118-210) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)} ppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsst ltltkdeyerhnsytceathktstspivksfnr
Timeline for d2ck0l2: