Lineage for d2ck0l1 (2ck0 L:1-117)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 546420Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)
  6. 547289Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 547602Species Mouse (Mus musculus), cluster 1.2 [TaxId:10090] [88525] (35 PDB entries)
  8. 547622Domain d2ck0l1: 2ck0 L:1-117 [100855]
    Other proteins in same PDB: d2ck0h1, d2ck0h2, d2ck0l2
    part of anti-anti-idiotypic Fab against human angiotensin II, complex with a synthetic cyclic peptide

Details for d2ck0l1

PDB Entry: 2ck0 (more details), 2.2 Å

PDB Description: anti-anti-idiotypic antibody against human angiotensin ii, complex with a synthetic cyclic peptide

SCOP Domain Sequences for d2ck0l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ck0l1 b.1.1.1 (L:1-117) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.2}
diqltqspsslavsagekvtmnckssqnllhsitrknylawyrqkpgqspklliywastr
gsgvpdrftgsgsgtdftltissvqaedlavyyckqsynlytfgggtkleikradaaptv
sif

SCOP Domain Coordinates for d2ck0l1:

Click to download the PDB-style file with coordinates for d2ck0l1.
(The format of our PDB-style files is described here.)

Timeline for d2ck0l1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ck0l2