SCOP 1.69: Domain d1vk6a2: 1vk6 A:126-256

Lineage for d1vk6a2 (1vk6 A:126-256)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.113: Nudix [55810] (1 superfamily)
   beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
   contains beta-grasp motif

4. Superfamily d.113.1: Nudix [55811] (5 families)

5. Family d.113.1.4: NADH pyrophosphatase [103214] (1 protein)
   duplication: consists of two structurally similar domains; the N-terminal domain has a rudiment Nudix fold, the C-terminal, probably catalytic, domain has the canonical fold

6. Protein NADH pyrophosphatase [103215] (1 species)

7. Species Escherichia coli [TaxId:562] [103216] (1 PDB entry)

8. Domain d1vk6a2: 1vk6 A:126-256 [100852]
   structural genomics

Details for d1vk6a2

PDB Entry: 1vk6, 2.2 Å

PDB Description: crystal structure of nadh pyrophosphatase (1790429) from escherichia coli k12 at 2.20 a resolution

SCOP Domain Sequences for d1vk6a2:

Sequence; same for both SEQRES and ATOM records:

>d1vk6a2 d.113.1.4 (A:126-256) NADH pyrophosphatase {Escherichia coli}
qiapciivairrddsillaqhtrhrngvhtvlagfvevgetleqavarevmeesgikvkn
lryvtsqpwpfpqslmtafmaeydsgdividpkelleanwyryddlpllpppgtvarrli
edtvamcraey

Timeline for d1vk6a2:

• d1vk6a2 first appeared in SCOP 1.67
  
• d1vk6a2 appears in SCOP 1.71
  
• d1vk6a2 appears in the current release, SCOPe 2.08