Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.72: Ribokinase-like [53612] (3 superfamilies) core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest potential superfamily: members of this fold have similar functions but different ATP-binding sites |
Superfamily c.72.1: Ribokinase-like [53613] (6 families) has extra strand located between strands 2 and 3 |
Family c.72.1.1: Ribokinase-like [53614] (10 proteins) automatically mapped to Pfam PF00294 |
Protein Hypothetical protein TM0415 [102641] (1 species) |
Species Thermotoga maritima [TaxId:2336] [102642] (1 PDB entry) |
Domain d1vk4a1: 1vk4 A:1-281 [100850] Other proteins in same PDB: d1vk4a2 structural genomics |
PDB Entry: 1vk4 (more details), 1.91 Å
SCOPe Domain Sequences for d1vk4a1:
Sequence, based on SEQRES records: (download)
>d1vk4a1 c.72.1.1 (A:1-281) Hypothetical protein TM0415 {Thermotoga maritima [TaxId: 2336]} mitfighvskdvnvvdgkreiaygggvvmgaitssllgvktkvitkctredvskfsflrd ngvevvflksprttsienrygsdpdtresflisaadpftesdlafiegeavhinplwyge fpedlipvlrrkvmflsadaqgfvrvpeneklvyrdwemkekylkyldlfkvdsreaetl tgtndlrescriirsfgakiilathasgvivfdgnfyeasfrswslegrtgrgdtctaaf lvgfvfkkmsiekatkfaaavtsvkmrhpgplrredleais
>d1vk4a1 c.72.1.1 (A:1-281) Hypothetical protein TM0415 {Thermotoga maritima [TaxId: 2336]} mitfighvskdvnvvdgkreiaygggvvmgaitssllgvktkvitkctredvskfsflrd ngvevvflksprttsienrytresflisaadpftesdlafiegeavhinplwygefpedl ipvlrrkvmflsadaqgfvrvpeneklvyrdwemkekylkyldlfkvdsreaetltgtnd lrescriirsfgakiilathasgvivfdgnfyeasfrswslegrtgrgdtctaaflvgfv fkkmsiekatkfaaavtsvkmrhpgplrredleais
Timeline for d1vk4a1: