Lineage for d1vk4a1 (1vk4 A:1-281)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2137471Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 2137472Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 2137473Family c.72.1.1: Ribokinase-like [53614] (10 protein domains)
    automatically mapped to Pfam PF00294
  6. 2137534Protein Hypothetical protein TM0415 [102641] (1 species)
  7. 2137535Species Thermotoga maritima [TaxId:2336] [102642] (1 PDB entry)
  8. 2137536Domain d1vk4a1: 1vk4 A:1-281 [100850]
    Other proteins in same PDB: d1vk4a2
    structural genomics

Details for d1vk4a1

PDB Entry: 1vk4 (more details), 1.91 Å

PDB Description: Crystal structure of PfkB Carbohydrate kinase (TM0415) from Thermotoga maritima at 1.91 A resolution
PDB Compounds: (A:) PfkB Carbohydrate kinase TM0415

SCOPe Domain Sequences for d1vk4a1:

Sequence, based on SEQRES records: (download)

>d1vk4a1 c.72.1.1 (A:1-281) Hypothetical protein TM0415 {Thermotoga maritima [TaxId: 2336]}
mitfighvskdvnvvdgkreiaygggvvmgaitssllgvktkvitkctredvskfsflrd
ngvevvflksprttsienrygsdpdtresflisaadpftesdlafiegeavhinplwyge
fpedlipvlrrkvmflsadaqgfvrvpeneklvyrdwemkekylkyldlfkvdsreaetl
tgtndlrescriirsfgakiilathasgvivfdgnfyeasfrswslegrtgrgdtctaaf
lvgfvfkkmsiekatkfaaavtsvkmrhpgplrredleais

Sequence, based on observed residues (ATOM records): (download)

>d1vk4a1 c.72.1.1 (A:1-281) Hypothetical protein TM0415 {Thermotoga maritima [TaxId: 2336]}
mitfighvskdvnvvdgkreiaygggvvmgaitssllgvktkvitkctredvskfsflrd
ngvevvflksprttsienrytresflisaadpftesdlafiegeavhinplwygefpedl
ipvlrrkvmflsadaqgfvrvpeneklvyrdwemkekylkyldlfkvdsreaetltgtnd
lrescriirsfgakiilathasgvivfdgnfyeasfrswslegrtgrgdtctaaflvgfv
fkkmsiekatkfaaavtsvkmrhpgplrredleais

SCOPe Domain Coordinates for d1vk4a1:

Click to download the PDB-style file with coordinates for d1vk4a1.
(The format of our PDB-style files is described here.)

Timeline for d1vk4a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vk4a2