![]() | Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
![]() | Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily) 3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold |
![]() | Superfamily d.139.1: PurM C-terminal domain-like [56042] (1 family) ![]() |
![]() | Family d.139.1.1: PurM C-terminal domain-like [56043] (2 proteins) |
![]() | Protein Phosphoribosylformylglycinamidine synthase II, domains 2 and 4 [103260] (1 species) duplication: tandem repeats of two PurM-like units arranged like the PurM subunits in the dimer |
![]() | Species Thermotoga maritima [TaxId:243274] [103261] (1 PDB entry) TM1246 |
![]() | Domain d1vk3a4: 1vk3 A:508-603 [100849] Other proteins in same PDB: d1vk3a1, d1vk3a2 structural genomics complexed with cl |
PDB Entry: 1vk3 (more details), 2.15 Å
SCOP Domain Sequences for d1vk3a4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vk3a4 d.139.1.1 (A:508-603) Phosphoribosylformylglycinamidine synthase II, domains 2 and 4 {Thermotoga maritima} akpkpskvfavgwndfelerekelwrairklseegafilsssqlltrthvetfreyglki evklpevrpahqmvlvfsertpvvdvpvkeigtlsr
Timeline for d1vk3a4: