SCOP 1.67: Domain d1vk3a3: 1vk3 A:167-345

Lineage for d1vk3a3 (1vk3 A:167-345)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily)
   3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold

4. Superfamily d.139.1: PurM C-terminal domain-like [56042] (1 family)

5. Family d.139.1.1: PurM C-terminal domain-like [56043] (2 proteins)

6. Protein Phosphoribosylformylglycinamidine synthase II, domains 2 and 4 [103260] (1 species)
   duplication: tandem repeats of two PurM-like units arranged like the PurM subunits in the dimer

7. Species Thermotoga maritima [TaxId:243274] [103261] (1 PDB entry)
   TM1246

8. Domain d1vk3a3: 1vk3 A:167-345 [100848]
   Other proteins in same PDB: d1vk3a1, d1vk3a2

Details for d1vk3a3

PDB Entry: 1vk3, 2.15 Å

PDB Description: Crystal structure of Phosphoribosylformylglycinamidine synthase II (TM1246) from Thermotoga maritima at 2.15 A resolution

SCOP Domain Sequences for d1vk3a3:

Sequence, based on SEQRES records:

>d1vk3a3 d.139.1.1 (A:167-345) Phosphoribosylformylglycinamidine synthase II, domains 2 and 4 {Thermotoga maritima}
kasrpgqvivifggatgrdgihgasfasedltgdkatklsiqvgdpfaekmlieaflemv
eeglvegaqdlgaggvlsatselvakgnlgaivhldrvplrepdmepweilisesqerma
vvtspqkasrileiarkhllfgdvvaevieepvyrvmyrndlvmevpvqllanapeedi

Sequence, based on observed residues (ATOM records):

>d1vk3a3 d.139.1.1 (A:167-345) Phosphoribosylformylglycinamidine synthase II, domains 2 and 4 {Thermotoga maritima}
kasrpgqvivifggatgrdgtklsiqvgdpfaekmlieaflemveeglvegaqdlgaggv
lsatselvakgnlgaivhldrvplrepdmepweilisesqermavvtspqkasrileiar
khllfgdvvaevieepvyrvmyrndlvmevpvqllanapeedi

Timeline for d1vk3a3:

• d1vk3a3 is new in SCOP 1.67
  
• d1vk3a3 appears in SCOP 1.69
  
• d1vk3a3 appears in the current release, SCOPe 2.08