Lineage for d1vk3a1 (1vk3 A:2-166)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 606051Fold d.79: Bacillus chorismate mutase-like [55297] (7 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 606282Superfamily d.79.4: PurM N-terminal domain-like [55326] (1 family) (S)
  5. 606283Family d.79.4.1: PurM N-terminal domain-like [55327] (4 proteins)
  6. 606294Protein Phosphoribosylformylglycinamidine synthase II, domains 1 and 3 [103082] (1 species)
    duplication: tandem repeats of two PurM-like units arranged like the PurM subunits in the dimer
  7. 606295Species Thermotoga maritima [TaxId:243274] [103083] (1 PDB entry)
    TM1246
  8. 606296Domain d1vk3a1: 1vk3 A:2-166 [100846]
    Other proteins in same PDB: d1vk3a3, d1vk3a4

Details for d1vk3a1

PDB Entry: 1vk3 (more details), 2.15 Å

PDB Description: Crystal structure of Phosphoribosylformylglycinamidine synthase II (TM1246) from Thermotoga maritima at 2.15 A resolution

SCOP Domain Sequences for d1vk3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vk3a1 d.79.4.1 (A:2-166) Phosphoribosylformylglycinamidine synthase II, domains 1 and 3 {Thermotoga maritima}
klrylnilkeklgreptfvelqafsvmwsehcgyshtkkyirrlpktgfegnagvvnldd
yysvafkieshnhpsaiepyngaatgvggiirdvlamgarptaifdslhmsriidgiieg
iadygnsigvptvggelrisslyahnplvnvlaagvvrndmlvds

SCOP Domain Coordinates for d1vk3a1:

Click to download the PDB-style file with coordinates for d1vk3a1.
(The format of our PDB-style files is described here.)

Timeline for d1vk3a1: