![]() | Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
![]() | Fold d.79: Bacillus chorismate mutase-like [55297] (7 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
![]() | Superfamily d.79.4: PurM N-terminal domain-like [55326] (1 family) ![]() |
![]() | Family d.79.4.1: PurM N-terminal domain-like [55327] (2 proteins) |
![]() | Protein Phosphoribosylformylglycinamidine synthase II, domains 1 and 3 [103082] (1 species) duplication: tandem repeats of two PurM-like units arranged like the PurM subunits in the dimer |
![]() | Species Thermotoga maritima [TaxId:243274] [103083] (1 PDB entry) TM1246 |
![]() | Domain d1vk3a1: 1vk3 A:2-166 [100846] Other proteins in same PDB: d1vk3a3, d1vk3a4 |
PDB Entry: 1vk3 (more details), 2.15 Å
SCOP Domain Sequences for d1vk3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vk3a1 d.79.4.1 (A:2-166) Phosphoribosylformylglycinamidine synthase II, domains 1 and 3 {Thermotoga maritima} klrylnilkeklgreptfvelqafsvmwsehcgyshtkkyirrlpktgfegnagvvnldd yysvafkieshnhpsaiepyngaatgvggiirdvlamgarptaifdslhmsriidgiieg iadygnsigvptvggelrisslyahnplvnvlaagvvrndmlvds
Timeline for d1vk3a1: