Lineage for d1vk2a_ (1vk2 A:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 691382Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 691383Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (3 families) (S)
  5. 691427Family c.18.1.2: Mug-like [52147] (2 proteins)
  6. 691435Protein Thermophilic uracil-DNA glycosylase [89577] (2 species)
  7. 691436Species Thermotoga maritima [TaxId:2336] [89578] (2 PDB entries)
    gene TM0511
  8. 691437Domain d1vk2a_: 1vk2 A: [100845]
    structural genomics
    complexed with fs4, unl

Details for d1vk2a_

PDB Entry: 1vk2 (more details), 1.9 Å

PDB Description: Crystal structure of Uracil-DNA glycosylase (TM0511) from Thermotoga maritima at 1.90 A resolution
PDB Compounds: (A:) Uracil-DNA glycosylase TM0511

SCOP Domain Sequences for d1vk2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vk2a_ c.18.1.2 (A:) Thermophilic uracil-DNA glycosylase {Thermotoga maritima [TaxId: 2336]}
mytreelmeivservkkctacplhlnrtnvvvgegnldtrivfvgegpgeeedktgrpfv
gragmlltellresgirredvyicnvvkcrppnnrtptpeeqaacghfllaqieiinpdv
ivalgatalsffvdgkkvsitkvrgnpidwlggkkviptfhpsyllrnrsnelrrivled
iekaksfikke

SCOP Domain Coordinates for d1vk2a_:

Click to download the PDB-style file with coordinates for d1vk2a_.
(The format of our PDB-style files is described here.)

Timeline for d1vk2a_: