![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134 |
![]() | Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (5 families) ![]() |
![]() | Family c.18.1.2: Mug-like [52147] (3 proteins) |
![]() | Protein Thermophilic uracil-DNA glycosylase [89577] (2 species) |
![]() | Species Thermotoga maritima [TaxId:2336] [89578] (2 PDB entries) gene TM0511 |
![]() | Domain d1vk2a_: 1vk2 A: [100845] structural genomics complexed with sf4, unl |
PDB Entry: 1vk2 (more details), 1.9 Å
SCOPe Domain Sequences for d1vk2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vk2a_ c.18.1.2 (A:) Thermophilic uracil-DNA glycosylase {Thermotoga maritima [TaxId: 2336]} mytreelmeivservkkctacplhlnrtnvvvgegnldtrivfvgegpgeeedktgrpfv gragmlltellresgirredvyicnvvkcrppnnrtptpeeqaacghfllaqieiinpdv ivalgatalsffvdgkkvsitkvrgnpidwlggkkviptfhpsyllrnrsnelrrivled iekaksfikke
Timeline for d1vk2a_: