Lineage for d1vk2a_ (1vk2 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855020Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 2855021Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (5 families) (S)
  5. 2855097Family c.18.1.2: Mug-like [52147] (3 proteins)
  6. 2855109Protein Thermophilic uracil-DNA glycosylase [89577] (2 species)
  7. 2855110Species Thermotoga maritima [TaxId:2336] [89578] (2 PDB entries)
    gene TM0511
  8. 2855111Domain d1vk2a_: 1vk2 A: [100845]
    structural genomics
    complexed with sf4, unl

Details for d1vk2a_

PDB Entry: 1vk2 (more details), 1.9 Å

PDB Description: Crystal structure of Uracil-DNA glycosylase (TM0511) from Thermotoga maritima at 1.90 A resolution
PDB Compounds: (A:) Uracil-DNA glycosylase TM0511

SCOPe Domain Sequences for d1vk2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vk2a_ c.18.1.2 (A:) Thermophilic uracil-DNA glycosylase {Thermotoga maritima [TaxId: 2336]}
mytreelmeivservkkctacplhlnrtnvvvgegnldtrivfvgegpgeeedktgrpfv
gragmlltellresgirredvyicnvvkcrppnnrtptpeeqaacghfllaqieiinpdv
ivalgatalsffvdgkkvsitkvrgnpidwlggkkviptfhpsyllrnrsnelrrivled
iekaksfikke

SCOPe Domain Coordinates for d1vk2a_:

Click to download the PDB-style file with coordinates for d1vk2a_.
(The format of our PDB-style files is described here.)

Timeline for d1vk2a_: