SCOP 1.73: Domain d1vk0f_: 1vk0 F:

Lineage for d1vk0f_ (1vk0 F:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (12 families)
   consists of one domain of this fold

5. Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (14 proteins)
   contains Pfam PF00929

6. Protein Hypothetical protein AT5G06450 [102483] (1 species)
   forms a ring-shaped hexamer; function unknown

7. Species Thale-cress (Arabidopsis thaliana) [TaxId:3702] [102484] (2 PDB entries)

8. Domain d1vk0f_: 1vk0 F: [100844]
   structural genomics

Details for d1vk0f_

PDB Entry: 1vk0, 2.1 Å

PDB Description: x-ray structure of gene product from arabidopsis thaliana at5g06450

PDB Compounds: (F:) hypothetical protein

SCOP Domain Sequences for d1vk0f_:

Sequence, based on SEQRES records:

>d1vk0f_ c.55.3.5 (F:) Hypothetical protein AT5G06450 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]}
sasfdgpkfkmtdgsyvqtktidvgsstdispylsliredsilngnravifdvywdvgfp
etetktktsgwslssvklstrnlclflrlpkpfhdnlkdlyrffaskfvtfvgvqieedl
dllrenhglvirnainvgklaaeargtlvleflgtrelahrvlwsdlgqldsieakweka
gpeeqleaaaiegwlivnvwdqlsde

Sequence, based on observed residues (ATOM records):

>d1vk0f_ c.55.3.5 (F:) Hypothetical protein AT5G06450 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]}
sasfdgpkfkmtdgsyvqtktidvgsstdispylsliredsilngnravifdvywdvgft
ktsgwslssvklstrnlclflrlpkpfhdnlkdlyrffaskfvtfvgvqieedldllren
hglvirnainvgklaaeargtlvleflgtrelahrvlwsdlgqldsieakwekagpeeql
eaaaiegwlivnvwdqlsde

Timeline for d1vk0f_:

• d1vk0f_ first appeared in SCOP 1.67
  
• d1vk0f_ appears in SCOP 1.71
  
• d1vk0f_ appears in SCOP 1.75
  
• d1vk0f_ appears in the current release, SCOPe 2.08, called d1vk0f1