Lineage for d1vk0e1 (1vk0 E:2-206)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2885833Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) (S)
    consists of one domain of this fold
  5. 2886484Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 proteins)
    contains Pfam PF00929
  6. 2886811Protein Hypothetical protein AT5G06450 [102483] (1 species)
    forms a ring-shaped hexamer; function unknown
  7. 2886812Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [102484] (2 PDB entries)
  8. 2886823Domain d1vk0e1: 1vk0 E:2-206 [100843]
    Other proteins in same PDB: d1vk0a2, d1vk0b2, d1vk0c2, d1vk0d2, d1vk0e2, d1vk0f2
    structural genomics

Details for d1vk0e1

PDB Entry: 1vk0 (more details), 2.1 Å

PDB Description: x-ray structure of gene product from arabidopsis thaliana at5g06450
PDB Compounds: (E:) hypothetical protein

SCOPe Domain Sequences for d1vk0e1:

Sequence, based on SEQRES records: (download)

>d1vk0e1 c.55.3.5 (E:2-206) Hypothetical protein AT5G06450 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
asfdgpkfkmtdgsyvqtktidvgsstdispylsliredsilngnravifdvywdvgfpe
tetktktsgwslssvklstrnlclflrlpkpfhdnlkdlyrffaskfvtfvgvqieedld
llrenhglvirnainvgklaaeargtlvleflgtrelahrvlwsdlgqldsieakwekag
peeqleaaaiegwlivnvwdqlsde

Sequence, based on observed residues (ATOM records): (download)

>d1vk0e1 c.55.3.5 (E:2-206) Hypothetical protein AT5G06450 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
asfdgpkfkmtdgsyvqtktidvgsstdispylsliredsilngnravifdvywdvgftk
tsgwslssvklstrnlclflrlpkpfhdnlkdlyrffaskfvtfvgvqieedldllrenh
glvirnainvgklaaeargtlvleflgtrelahrvlwsdlgqldsieakwekagpeeqle
aaaiegwlivnvwdqlsde

SCOPe Domain Coordinates for d1vk0e1:

Click to download the PDB-style file with coordinates for d1vk0e1.
(The format of our PDB-style files is described here.)

Timeline for d1vk0e1: