Lineage for d1vk0d_ (1vk0 D:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 397315Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 397627Superfamily c.55.3: Ribonuclease H-like [53098] (9 families) (S)
    consists of one domain of this fold
  5. 397834Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (7 proteins)
  6. 397930Protein Hypothetical protein AT5G06450 [102483] (1 species)
    forms a ring-shaped hexamer; function unknown
  7. 397931Species Thale-cress (Arabidopsis thaliana) [TaxId:3702] [102484] (1 PDB entry)
  8. 397935Domain d1vk0d_: 1vk0 D: [100842]

Details for d1vk0d_

PDB Entry: 1vk0 (more details), 2.1 Å

PDB Description: x-ray structure of gene product from arabidopsis thaliana at5g06450

SCOP Domain Sequences for d1vk0d_:

Sequence, based on SEQRES records: (download)

>d1vk0d_ c.55.3.5 (D:) Hypothetical protein AT5G06450 {Thale-cress (Arabidopsis thaliana)}
sasfdgpkfkmtdgsyvqtktidvgsstdispylsliredsilngnravifdvywdvgfp
etetktktsgwslssvklstrnlclflrlpkpfhdnlkdlyrffaskfvtfvgvqieedl
dllrenhglvirnainvgklaaeargtlvleflgtrelahrvlwsdlgqldsieakweka
gpeeqleaaaiegwlivnvwdqlsde

Sequence, based on observed residues (ATOM records): (download)

>d1vk0d_ c.55.3.5 (D:) Hypothetical protein AT5G06450 {Thale-cress (Arabidopsis thaliana)}
sasfdgpkfkmtdgsyvqtktidvgsstdispylsliredsilngnravifdvywdvgft
ktsgwslssvklstrnlclflrlpkpfhdnlkdlyrffaskfvtfvgvqieedldllren
hglvirnainvgklaaeargtlvleflgtrelahrvlwsdlgqldsieakwekagpeeql
eaaaiegwlivnvwdqlsde

SCOP Domain Coordinates for d1vk0d_:

Click to download the PDB-style file with coordinates for d1vk0d_.
(The format of our PDB-style files is described here.)

Timeline for d1vk0d_: