Lineage for d1vk0a_ (1vk0 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1857400Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1859086Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 1859666Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (16 proteins)
    contains Pfam PF00929
  6. 1859975Protein Hypothetical protein AT5G06450 [102483] (1 species)
    forms a ring-shaped hexamer; function unknown
  7. 1859976Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [102484] (2 PDB entries)
  8. 1859983Domain d1vk0a_: 1vk0 A: [100839]
    structural genomics

Details for d1vk0a_

PDB Entry: 1vk0 (more details), 2.1 Å

PDB Description: x-ray structure of gene product from arabidopsis thaliana at5g06450
PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d1vk0a_:

Sequence, based on SEQRES records: (download)

>d1vk0a_ c.55.3.5 (A:) Hypothetical protein AT5G06450 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
sasfdgpkfkmtdgsyvqtktidvgsstdispylsliredsilngnravifdvywdvgfp
etetktktsgwslssvklstrnlclflrlpkpfhdnlkdlyrffaskfvtfvgvqieedl
dllrenhglvirnainvgklaaeargtlvleflgtrelahrvlwsdlgqldsieakweka
gpeeqleaaaiegwlivnvwdqlsde

Sequence, based on observed residues (ATOM records): (download)

>d1vk0a_ c.55.3.5 (A:) Hypothetical protein AT5G06450 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
sasfdgpkfkmtdgsyvqtktidvgsstdispylsliredsilngnravifdvywdvgft
ktsgwslssvklstrnlclflrlpkpfhdnlkdlyrffaskfvtfvgvqieedldllren
hglvirnainvgklaaeargtlvleflgtrelahrvlwsdlgqldsieakwekagpeeql
eaaaiegwlivnvwdqlsde

SCOPe Domain Coordinates for d1vk0a_:

Click to download the PDB-style file with coordinates for d1vk0a_.
(The format of our PDB-style files is described here.)

Timeline for d1vk0a_: