Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (10 families) consists of one domain of this fold |
Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (7 proteins) |
Protein Hypothetical protein AT5G06450 [102483] (1 species) forms a ring-shaped hexamer; function unknown |
Species Thale-cress (Arabidopsis thaliana) [TaxId:3702] [102484] (1 PDB entry) |
Domain d1vk0a_: 1vk0 A: [100839] |
PDB Entry: 1vk0 (more details), 2.1 Å
SCOP Domain Sequences for d1vk0a_:
Sequence, based on SEQRES records: (download)
>d1vk0a_ c.55.3.5 (A:) Hypothetical protein AT5G06450 {Thale-cress (Arabidopsis thaliana)} sasfdgpkfkmtdgsyvqtktidvgsstdispylsliredsilngnravifdvywdvgfp etetktktsgwslssvklstrnlclflrlpkpfhdnlkdlyrffaskfvtfvgvqieedl dllrenhglvirnainvgklaaeargtlvleflgtrelahrvlwsdlgqldsieakweka gpeeqleaaaiegwlivnvwdqlsde
>d1vk0a_ c.55.3.5 (A:) Hypothetical protein AT5G06450 {Thale-cress (Arabidopsis thaliana)} sasfdgpkfkmtdgsyvqtktidvgsstdispylsliredsilngnravifdvywdvgft ktsgwslssvklstrnlclflrlpkpfhdnlkdlyrffaskfvtfvgvqieedldllren hglvirnainvgklaaeargtlvleflgtrelahrvlwsdlgqldsieakwekagpeeql eaaaiegwlivnvwdqlsde
Timeline for d1vk0a_: