SCOPe 2.08: Domain d1vk0a1: 1vk0 A:2-206

Lineage for d1vk0a1 (1vk0 A:2-206)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (18 families)
   consists of one domain of this fold

5. Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 proteins)
   contains Pfam PF00929

6. Protein Hypothetical protein AT5G06450 [102483] (1 species)
   forms a ring-shaped hexamer; function unknown

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [102484] (2 PDB entries)

8. Domain d1vk0a1: 1vk0 A:2-206 [100839]
   Other proteins in same PDB: d1vk0a2, d1vk0b2, d1vk0c2, d1vk0d2, d1vk0e2, d1vk0f2
   structural genomics

Details for d1vk0a1

PDB Entry: 1vk0, 2.1 Å

PDB Description: x-ray structure of gene product from arabidopsis thaliana at5g06450

PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d1vk0a1:

Sequence, based on SEQRES records:

>d1vk0a1 c.55.3.5 (A:2-206) Hypothetical protein AT5G06450 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
asfdgpkfkmtdgsyvqtktidvgsstdispylsliredsilngnravifdvywdvgfpe
tetktktsgwslssvklstrnlclflrlpkpfhdnlkdlyrffaskfvtfvgvqieedld
llrenhglvirnainvgklaaeargtlvleflgtrelahrvlwsdlgqldsieakwekag
peeqleaaaiegwlivnvwdqlsde

Sequence, based on observed residues (ATOM records):

>d1vk0a1 c.55.3.5 (A:2-206) Hypothetical protein AT5G06450 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
asfdgpkfkmtdgsyvqtktidvgsstdispylsliredsilngnravifdvywdvgftk
tsgwslssvklstrnlclflrlpkpfhdnlkdlyrffaskfvtfvgvqieedldllrenh
glvirnainvgklaaeargtlvleflgtrelahrvlwsdlgqldsieakwekagpeeqle
aaaiegwlivnvwdqlsde

Timeline for d1vk0a1:

• d1vk0a1 first appeared in SCOP 1.67, called d1vk0a_
  
• d1vk0a1 appears in SCOPe 2.07