Lineage for d1vjza_ (1vjz A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2830557Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 2830960Protein Endoglucanase homologue TM1752 [102066] (1 species)
  7. 2830961Species Thermotoga maritima [TaxId:2336] [102067] (1 PDB entry)
  8. 2830962Domain d1vjza_: 1vjz A: [100838]
    structural genomics

Details for d1vjza_

PDB Entry: 1vjz (more details), 2.05 Å

PDB Description: crystal structure of endoglucanase (tm1752) from thermotoga maritima at 2.05 a resolution
PDB Compounds: (A:) endoglucanase

SCOPe Domain Sequences for d1vjza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vjza_ c.1.8.3 (A:) Endoglucanase homologue TM1752 {Thermotoga maritima [TaxId: 2336]}
iprwrgfnlleafsikstgnfkeedflwmaqwdfnfvripmchllwsdrgnpfiiredff
ekidrvifwgekygihicislhrapgysvnkeveektnlwkdetaqeafihhwsfiarry
kgissthlsfnlineppfpdpqimsvedhnslikrtiteirkidperliiidglgygnip
vddltientvqscrgyipfsvthykaewvdskdfpvpewpngwhfgeywnrekllehylt
wiklrqkgievfcgemgaynktphdvvlkwledlleifktlnigfalwnfrgpfgildse
rkdveyeewyghkldrkmlellrky

SCOPe Domain Coordinates for d1vjza_:

Click to download the PDB-style file with coordinates for d1vjza_.
(The format of our PDB-style files is described here.)

Timeline for d1vjza_: