SCOPe 2.08: Domain d1vjxa1: 1vjx A:1-145

Lineage for d1vjxa1 (1vjx A:1-145)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.1: Ferritin [47241] (10 proteins)

6. Protein Hypothetical protein TM1526 [101132] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [101133] (1 PDB entry)

8. Domain d1vjxa1: 1vjx A:1-145 [100837]
   Other proteins in same PDB: d1vjxa2
   structural genomics

Details for d1vjxa1

PDB Entry: 1vjx, 2.3 Å

PDB Description: Crystal structure of a putative ferritin-like diiron-carboxylate protein (tm1526) from thermotoga maritima at 2.30 A resolution

PDB Compounds: (A:) putative ferritin-like diiron-carboxylate protein TM1526

SCOPe Domain Sequences for d1vjxa1:

Sequence; same for both SEQRES and ATOM records:

>d1vjxa1 a.25.1.1 (A:1-145) Hypothetical protein TM1526 {Thermotoga maritima [TaxId: 2336]}
mkvsdiltvairleeegerfyrelsehfngeikktfleladqerihaeifrkmsdqenwd
evdsylagyafyevfpdtseilrrkdltlkevldiaisvekdsiilyyelkdglvnsdaq
ktvkkiidqekehlrkllemkrest

Timeline for d1vjxa1:

• d1vjxa1 first appeared in SCOP 1.67, called d1vjxa_
  
• d1vjxa1 appears in SCOPe 2.07