Lineage for d1vjxa1 (1vjx A:1-145)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1988413Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1988414Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1988415Family a.25.1.1: Ferritin [47241] (10 protein domains)
  6. 1989228Protein Hypothetical protein TM1526 [101132] (1 species)
  7. 1989229Species Thermotoga maritima [TaxId:2336] [101133] (1 PDB entry)
  8. 1989230Domain d1vjxa1: 1vjx A:1-145 [100837]
    Other proteins in same PDB: d1vjxa2
    structural genomics

Details for d1vjxa1

PDB Entry: 1vjx (more details), 2.3 Å

PDB Description: Crystal structure of a putative ferritin-like diiron-carboxylate protein (tm1526) from thermotoga maritima at 2.30 A resolution
PDB Compounds: (A:) putative ferritin-like diiron-carboxylate protein TM1526

SCOPe Domain Sequences for d1vjxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vjxa1 a.25.1.1 (A:1-145) Hypothetical protein TM1526 {Thermotoga maritima [TaxId: 2336]}
mkvsdiltvairleeegerfyrelsehfngeikktfleladqerihaeifrkmsdqenwd
evdsylagyafyevfpdtseilrrkdltlkevldiaisvekdsiilyyelkdglvnsdaq
ktvkkiidqekehlrkllemkrest

SCOPe Domain Coordinates for d1vjxa1:

Click to download the PDB-style file with coordinates for d1vjxa1.
(The format of our PDB-style files is described here.)

Timeline for d1vjxa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vjxa2