Lineage for d1vjua1 (1vju A:9-309)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2240906Fold d.248: Coproporphyrinogen III oxidase [102885] (2 superfamilies)
    alpha-beta(6)-alpha(2)-beta-alpha(n); 3 layers alpha/beta/alpha; antiparallel sheet: order 1234567
  4. 2240907Superfamily d.248.1: Coproporphyrinogen III oxidase [102886] (2 families) (S)
    automatically mapped to Pfam PF01218
  5. 2240908Family d.248.1.1: Coproporphyrinogen III oxidase [102887] (3 proteins)
    Pfam PF01218
  6. 2240922Protein Hypothetical protein Lmaj006828 [102888] (1 species)
  7. 2240923Species Leishmania major [TaxId:5664] [102889] (1 PDB entry)
  8. 2240924Domain d1vjua1: 1vju A:9-309 [100835]
    Other proteins in same PDB: d1vjua2, d1vjub2
    structural genomics

Details for d1vjua1

PDB Entry: 1vju (more details), 1.4 Å

PDB Description: coproporphyrinogen iii oxidase from leishmania major
PDB Compounds: (A:) Coproporphyrinogen III oxidase

SCOPe Domain Sequences for d1vjua1:

Sequence, based on SEQRES records: (download)

>d1vjua1 d.248.1.1 (A:9-309) Hypothetical protein Lmaj006828 {Leishmania major [TaxId: 5664]}
mslaveavkdfllklqddicealeaedgqatfvedkwtregggggrtrvmvdgaviekgg
vnfshvygkglpmssterhpdiagcnfeamgvslvihpknphvptshanvrlfvaeregk
epvwwfgggfdltpyyaveedcrdfhqvaqdlckpfgadvyarfkgwcdeyffipyrnea
rgigglffddlnewpfekcfefvqavgkgymdayipivnrrkntpyteqqvefqefrrgr
yaefnlvidrgtkfglqsggrtesilislpprarwgynwqpepgtpearlteyfltkrqw
v

Sequence, based on observed residues (ATOM records): (download)

>d1vjua1 d.248.1.1 (A:9-309) Hypothetical protein Lmaj006828 {Leishmania major [TaxId: 5664]}
mslaveavkdfllklqddicealeaedgqatfvedkwtregggggrtrvmvdgaviekgg
vnfshvygkgiagcnfeamgvslvihpknphvptshanvrlfvaeregkepvwwfgggfd
ltpyyaveedcrdfhqvaqdlckpfgadvyarfkgwcdeyffipyrneargigglffddl
newpfekcfefvqavgkgymdayipivnrrkntpyteqqvefqefrrgryaefnlvidrg
tkfglqsggrtesilislpprarwgynwqpepgtpearlteyfltkrqwv

SCOPe Domain Coordinates for d1vjua1:

Click to download the PDB-style file with coordinates for d1vjua1.
(The format of our PDB-style files is described here.)

Timeline for d1vjua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vjua2