Lineage for d1vjua_ (1vju A:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 423442Fold d.248: Coproporphyrinogen III oxidase [102885] (1 superfamily)
    alpha-beta(6)-alpha(2)-beta-alpha(n); 3 layers alpha/beta/alpha; antiparallel sheet: order 1234567
  4. 423443Superfamily d.248.1: Coproporphyrinogen III oxidase [102886] (1 family) (S)
  5. 423444Family d.248.1.1: Coproporphyrinogen III oxidase [102887] (1 protein)
    Pfam 01218
  6. 423445Protein Hypothetical protein Lmaj006828 [102888] (1 species)
  7. 423446Species Leishmania major [TaxId:5664] [102889] (1 PDB entry)
  8. 423447Domain d1vjua_: 1vju A: [100835]

Details for d1vjua_

PDB Entry: 1vju (more details), 1.4 Å

PDB Description: coproporphyrinogen iii oxidase from leishmania major

SCOP Domain Sequences for d1vjua_:

Sequence, based on SEQRES records: (download)

>d1vjua_ d.248.1.1 (A:) Hypothetical protein Lmaj006828 {Leishmania major}
hmslaveavkdfllklqddicealeaedgqatfvedkwtregggggrtrvmvdgaviekg
gvnfshvygkglpmssterhpdiagcnfeamgvslvihpknphvptshanvrlfvaereg
kepvwwfgggfdltpyyaveedcrdfhqvaqdlckpfgadvyarfkgwcdeyffipyrne
argigglffddlnewpfekcfefvqavgkgymdayipivnrrkntpyteqqvefqefrrg
ryaefnlvidrgtkfglqsggrtesilislpprarwgynwqpepgtpearlteyfltkrq
wv

Sequence, based on observed residues (ATOM records): (download)

>d1vjua_ d.248.1.1 (A:) Hypothetical protein Lmaj006828 {Leishmania major}
hmslaveavkdfllklqddicealeaedgqatfvedkwtregggggrtrvmvdgaviekg
gvnfshvygkgiagcnfeamgvslvihpknphvptshanvrlfvaeregkepvwwfgggf
dltpyyaveedcrdfhqvaqdlckpfgadvyarfkgwcdeyffipyrneargigglffdd
lnewpfekcfefvqavgkgymdayipivnrrkntpyteqqvefqefrrgryaefnlvidr
gtkfglqsggrtesilislpprarwgynwqpepgtpearlteyfltkrqwv

SCOP Domain Coordinates for d1vjua_:

Click to download the PDB-style file with coordinates for d1vjua_.
(The format of our PDB-style files is described here.)

Timeline for d1vjua_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1vjub_