Lineage for d1vjra1 (1vjr A:1-259)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2526731Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2526732Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2527348Family c.108.1.14: NagD-like [102317] (7 proteins)
    duplication: consists of two segment-swapped domains of this fold; this results in the insertion of a circularly permuted domain after strand 3, analogously to the Cof family
  6. 2527352Protein Hypothetical protein TM1742 [102318] (1 species)
    putative NagD protein
  7. 2527353Species Thermotoga maritima [TaxId:2336] [102319] (2 PDB entries)
  8. 2527354Domain d1vjra1: 1vjr A:1-259 [100832]
    Other proteins in same PDB: d1vjra2
    structural genomics
    complexed with cl, ni

Details for d1vjra1

PDB Entry: 1vjr (more details), 2.4 Å

PDB Description: Crystal structure of 4-nitrophenylphosphatase (TM1742) from Thermotoga maritima at 2.40 A resolution
PDB Compounds: (A:) 4-nitrophenylphosphatase

SCOPe Domain Sequences for d1vjra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vjra1 c.108.1.14 (A:1-259) Hypothetical protein TM1742 {Thermotoga maritima [TaxId: 2336]}
vldkielfildmdgtfylddsllpgslefletlkeknkrfvfftnnsslgaqdyvrklrn
mgvdvpddavvtsgeitaehmlkrfgrcrifllgtpqlkkvfeayghvideenpdfvvlg
fdktltyerlkkacillrkgkfyiathpdincpskegpvpdagsimaaieastgrkpdli
agkpnplvvdvisekfgvpkermamvgdrlytdvklgknagivsilvltgettpedlera
etkpdfvfknlgelakavq

SCOPe Domain Coordinates for d1vjra1:

Click to download the PDB-style file with coordinates for d1vjra1.
(The format of our PDB-style files is described here.)

Timeline for d1vjra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vjra2