SCOPe 2.08: Domain d1vjra1: 1vjr A:1-259

Lineage for d1vjra1 (1vjr A:1-259)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.14: NagD-like [102317] (7 proteins)
   duplication: consists of two segment-swapped domains of this fold; this results in the insertion of a circularly permuted domain after strand 3, analogously to the Cof family

6. Protein Hypothetical protein TM1742 [102318] (1 species)
   putative NagD protein

7. Species Thermotoga maritima [TaxId:2336] [102319] (2 PDB entries)

8. Domain d1vjra1: 1vjr A:1-259 [100832]
   Other proteins in same PDB: d1vjra2
   structural genomics
   complexed with cl, ni

Details for d1vjra1

PDB Entry: 1vjr, 2.4 Å

PDB Description: Crystal structure of 4-nitrophenylphosphatase (TM1742) from Thermotoga maritima at 2.40 A resolution

PDB Compounds: (A:) 4-nitrophenylphosphatase

SCOPe Domain Sequences for d1vjra1:

Sequence; same for both SEQRES and ATOM records:

>d1vjra1 c.108.1.14 (A:1-259) Hypothetical protein TM1742 {Thermotoga maritima [TaxId: 2336]}
vldkielfildmdgtfylddsllpgslefletlkeknkrfvfftnnsslgaqdyvrklrn
mgvdvpddavvtsgeitaehmlkrfgrcrifllgtpqlkkvfeayghvideenpdfvvlg
fdktltyerlkkacillrkgkfyiathpdincpskegpvpdagsimaaieastgrkpdli
agkpnplvvdvisekfgvpkermamvgdrlytdvklgknagivsilvltgettpedlera
etkpdfvfknlgelakavq

Timeline for d1vjra1:

• d1vjra1 first appeared in SCOP 1.67, called d1vjra_
  
• d1vjra1 appears in SCOPe 2.07