Lineage for d1vjqb_ (1vjq B:)

  1. Root: SCOP 1.69
  2. 529903Class k: Designed proteins [58788] (42 folds)
  3. 530451Fold k.43: Carboxypeptidase A prodomain-based design [103789] (1 superfamily)
  4. 530452Superfamily k.43.1: Carboxypeptidase A prodomain-based design [103790] (1 family) (S)
  5. 530453Family k.43.1.1: Carboxypeptidase A prodomain-based design [103791] (1 protein)
  6. 530454Protein Carboxypeptidase A prodomain-based design [103792] (1 species)
  7. 530455Species Synthetic, sequence chosen for maximal predicted stability [103793] (1 PDB entry)
  8. 530457Domain d1vjqb_: 1vjq B: [100831]

Details for d1vjqb_

PDB Entry: 1vjq (more details), 2.1 Å

PDB Description: designed protein based on backbone conformation of procarboxypeptidase-a (1aye) with sidechains chosen for maximal predicted stability.

SCOP Domain Sequences for d1vjqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vjqb_ k.43.1.1 (B:) Carboxypeptidase A prodomain-based design {Synthetic, sequence chosen for maximal predicted stability}
ktifvivptneeqvaflealakqdelnfdwqnpptepgqpvvilipsdmvewflemlkak
gipftvyveeggs

SCOP Domain Coordinates for d1vjqb_:

Click to download the PDB-style file with coordinates for d1vjqb_.
(The format of our PDB-style files is described here.)

Timeline for d1vjqb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1vjqa_