Lineage for d1vjqb_ (1vjq B:)
- Root: SCOP 1.67
Class k: Designed proteins [58788] (41 folds) 
Fold k.43: Carboxypeptidase A prodomain-based design [103789] (1 superfamily) Superfamily k.43.1: Carboxypeptidase A prodomain-based design [103790] (1 family) 
Family k.43.1.1: Carboxypeptidase A prodomain-based design [103791] (1 protein) Protein Carboxypeptidase A prodomain-based design [103792] (1 species) Species Synthetic, sequence chosen for maximal predicted stability [103793] (1 PDB entry) 
Domain d1vjqb_: 1vjq B: [100831]
Details for d1vjqb_
PDB Entry: 1vjq (more details), 2.1 Å
PDB Description: designed protein based on backbone conformation of procarboxypeptidase-a (1aye) with sidechains chosen for maximal predicted stability.
SCOP Domain Sequences for d1vjqb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vjqb_ k.43.1.1 (B:) Carboxypeptidase A prodomain-based design {Synthetic, sequence chosen for maximal predicted stability}
ktifvivptneeqvaflealakqdelnfdwqnpptepgqpvvilipsdmvewflemlkak
gipftvyveeggs
SCOP Domain Coordinates for d1vjqb_:
Click to download the PDB-style file with coordinates for d1vjqb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1vjqb_:
- d1vjqb_ is new in SCOP 1.67
- d1vjqb_ appears in SCOP 1.69
- d1vjqb_ appears in the current release, SCOPe 2.08
View in 3D
