Lineage for d1vjoa_ (1vjo A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2131439Family c.67.1.3: Cystathionine synthase-like [53402] (17 protein domains)
  6. 2131451Protein Alanine-glyoxylate aminotransferase [89757] (3 species)
  7. 2131457Species Nostoc sp. PCC 7120 [TaxId:103690] [102598] (1 PDB entry)
    alr1004
  8. 2131458Domain d1vjoa_: 1vjo A: [100827]
    structural genomics
    complexed with plp

Details for d1vjoa_

PDB Entry: 1vjo (more details), 1.7 Å

PDB Description: Crystal structure of Alanine--glyoxylate aminotransferase (ALR1004) from Nostoc sp. at 1.70 A resolution
PDB Compounds: (A:) alanine--glyoxylate aminotransferase

SCOPe Domain Sequences for d1vjoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vjoa_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Nostoc sp. PCC 7120 [TaxId: 103690]}
isindnqrlqleplevpsrlllgpgpsnahpsvlqamnvspvghldpaflalmdeiqsll
ryvwqtenpltiavsgtgtaameatianavepgdvvligvagyfgnrlvdmagrygadvr
tiskpwgevfsleelrtalethrpailalvhaetstgarqplegvgelcrefgtlllvdt
vtslggvpifldawgvdlayscsqkglgcspgaspftmssraieklqrrrtkvanwyldm
nllgkywgservyhhtapinlyyalrealrliaqeglancwqrhqknveylwerledigl
slhvekeyrlptlttvcipdgvdgkavarrllnehnievggglgelagkvwrvglmgfns
rkesvdqlipaleqvlr

SCOPe Domain Coordinates for d1vjoa_:

Click to download the PDB-style file with coordinates for d1vjoa_.
(The format of our PDB-style files is described here.)

Timeline for d1vjoa_: