Lineage for d1vjnb1 (1vjn B:1-207)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2602905Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2602906Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2603372Family d.157.1.4: Hypothetical protein TM0207 [103317] (1 protein)
  6. 2603373Protein Hypothetical protein TM0207 [103318] (1 species)
  7. 2603374Species Thermotoga maritima [TaxId:2336] [103319] (1 PDB entry)
  8. 2603376Domain d1vjnb1: 1vjn B:1-207 [100826]
    Other proteins in same PDB: d1vjna2, d1vjnb2
    structural genomics

Details for d1vjnb1

PDB Entry: 1vjn (more details), 2 Å

PDB Description: Crystal structure of a putative zn-dependent hydrolase of the metallo-beta-lactamase superfamily (tm0207) from thermotoga maritima at 2.00 A resolution
PDB Compounds: (B:) Zn-dependent hydrolase of metallo-beta-lactamase superfamily TM0207

SCOPe Domain Sequences for d1vjnb1:

Sequence, based on SEQRES records: (download)

>d1vjnb1 d.157.1.4 (B:1-207) Hypothetical protein TM0207 {Thermotoga maritima [TaxId: 2336]}
mkitwfghacfalemegktivtdpfdesvgypipnvtadvvteshqhfdhnahhlvkgnf
rvidrpgaytvngvkikgvetfhdpshgrergknivfvfegegikvchlgdlghvltpaq
veeigeidvllvpvggtytigpkeakevadllnakviipmhyktkylkfnllpvddflkl
fdsyervgnilelfekpkerkvvvmev

Sequence, based on observed residues (ATOM records): (download)

>d1vjnb1 d.157.1.4 (B:1-207) Hypothetical protein TM0207 {Thermotoga maritima [TaxId: 2336]}
mkitwfghacfalemegktivtdpfypipnvtadvvteshqnahhlvkgnfrvidrpgay
tvngvkikgvetfknivfvfegegikvchlgdlghvltpaqveeigeidvllvpvggtyt
igpkeakevadllnakviipmhyktkylkfnllpvddflklfdsyervgnilelfekpke
rkvvvmev

SCOPe Domain Coordinates for d1vjnb1:

Click to download the PDB-style file with coordinates for d1vjnb1.
(The format of our PDB-style files is described here.)

Timeline for d1vjnb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vjnb2