![]() | Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
![]() | Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily) duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets |
![]() | Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (4 families) ![]() |
![]() | Family d.157.1.4: Hypothetical protein TM0207 [103317] (1 protein) |
![]() | Protein Hypothetical protein TM0207 [103318] (1 species) |
![]() | Species Thermotoga maritima [TaxId:243274] [103319] (1 PDB entry) |
![]() | Domain d1vjnb_: 1vjn B: [100826] structural genomics |
PDB Entry: 1vjn (more details), 2 Å
SCOP Domain Sequences for d1vjnb_:
Sequence, based on SEQRES records: (download)
>d1vjnb_ d.157.1.4 (B:) Hypothetical protein TM0207 {Thermotoga maritima} hmkitwfghacfalemegktivtdpfdesvgypipnvtadvvteshqhfdhnahhlvkgn frvidrpgaytvngvkikgvetfhdpshgrergknivfvfegegikvchlgdlghvltpa qveeigeidvllvpvggtytigpkeakevadllnakviipmhyktkylkfnllpvddflk lfdsyervgnilelfekpkerkvvvmev
>d1vjnb_ d.157.1.4 (B:) Hypothetical protein TM0207 {Thermotoga maritima} hmkitwfghacfalemegktivtdpfypipnvtadvvteshqnahhlvkgnfrvidrpga ytvngvkikgvetfknivfvfegegikvchlgdlghvltpaqveeigeidvllvpvggty tigpkeakevadllnakviipmhyktkylkfnllpvddflklfdsyervgnilelfekpk erkvvvmev
Timeline for d1vjnb_: