SCOPe 2.08: Domain d1vjnb1: 1vjn B:1-207

Lineage for d1vjnb1 (1vjn B:1-207)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families)

5. Family d.157.1.4: Hypothetical protein TM0207 [103317] (1 protein)

6. Protein Hypothetical protein TM0207 [103318] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [103319] (1 PDB entry)

8. Domain d1vjnb1: 1vjn B:1-207 [100826]
   Other proteins in same PDB: d1vjna2, d1vjnb2
   structural genomics

Details for d1vjnb1

PDB Entry: 1vjn, 2 Å

PDB Description: Crystal structure of a putative zn-dependent hydrolase of the metallo-beta-lactamase superfamily (tm0207) from thermotoga maritima at 2.00 A resolution

PDB Compounds: (B:) Zn-dependent hydrolase of metallo-beta-lactamase superfamily TM0207

SCOPe Domain Sequences for d1vjnb1:

Sequence, based on SEQRES records:

>d1vjnb1 d.157.1.4 (B:1-207) Hypothetical protein TM0207 {Thermotoga maritima [TaxId: 2336]}
mkitwfghacfalemegktivtdpfdesvgypipnvtadvvteshqhfdhnahhlvkgnf
rvidrpgaytvngvkikgvetfhdpshgrergknivfvfegegikvchlgdlghvltpaq
veeigeidvllvpvggtytigpkeakevadllnakviipmhyktkylkfnllpvddflkl
fdsyervgnilelfekpkerkvvvmev

Sequence, based on observed residues (ATOM records):

>d1vjnb1 d.157.1.4 (B:1-207) Hypothetical protein TM0207 {Thermotoga maritima [TaxId: 2336]}
mkitwfghacfalemegktivtdpfypipnvtadvvteshqnahhlvkgnfrvidrpgay
tvngvkikgvetfknivfvfegegikvchlgdlghvltpaqveeigeidvllvpvggtyt
igpkeakevadllnakviipmhyktkylkfnllpvddflklfdsyervgnilelfekpke
rkvvvmev

Timeline for d1vjnb1:

• d1vjnb1 first appeared in SCOP 1.67, called d1vjnb_
  
• d1vjnb1 appears in SCOPe 2.07